ABclonal
Recombinant Human TNFSF13/APRIL/CD256 Protein - RP01777
Recombinant Human TNFSF13/APRIL/CD256 Protein - RP01777
Couldn't load pickup availability
Recombinant Human TNFSF13/APRIL/CD256 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01777-10, RP01777-20, RP01777-50, RP01777-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFSF13/APRIL/CD256 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys111-leu250) of human TNFSF13 (Accession #NP_001185552.1) fused with and a hFc tag at the N-terminus.
Alternate Names: APRIL; CD256; TALL2; ZTNF2; TALL-2; TNLG7B; TRDL-1; UNQ383/PRO715; TNFSF13
SWISS: O75888
GeneID: 8741
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: TNFSF13 is a member of the tumor necrosis factor (TNF) ligand family. It is a ligand for TNFRSF17/BCMA. TNFSF13 is lowly expressed in normal tissues, but is elevated in several types of tumors and transformed cell lines. It is important for B cell development. TNFSF13 may also play a role in T-independent type II antigen responses and T cell survival, and induce proliferation/survival of non lymphoid cells. It exists as a functional homotrimer. It can bind to two cell surface receptors, BCMA and TACI, which it shares with BAFF to exert downstream T- and B-cell regulatory effects. TNFSF13 also has been demonstrated to bind to proteoglycans on the cell surface.
Source: HEK293 cells
Tag: N-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: KQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
