Recombinant Human TNFSF14/LIGHT/HVEM-L/CD258 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01336-10, RP01336-20, RP01336-50, RP01336-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFSF14/LIGHT/HVEM-L/CD258 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp74-Val240) of Human TNFSF14 (Accession #NP_003798.2) fused with a 6×His tag at the N-terminus.
Alternate Names: TNFSF14, CD258, HVEML, LIGHT, LTg
SWISS: O43557
GeneID: 8740
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: LIGHT, also known as TNFSF14 or CD258, is a newly identified member of the TNF superfamily (TNFSF14) that is expressed by activated T lymphocytes, monocytes, granulocytes, spleen cells, and immature dendritic cells. TNFSF14 / LIGHT / CD258 is a type II transmembrane protein that is known to bind 2 membrane-bound TNFSF signaling receptors: HVEM, which is predominantly expressed by T cells, and lymphotoxin β receptor (LTβR), which is expressed by stromal cells and nonlymphoid hematopoietic cells. TNFSF14 / LIGHT / CD258 also binds to a soluble non-signaling receptor, decoy receptor 3 (DcR3), which can modulate the function of LIGHT in vivo. TNFSF14 / LIGHT / CD258 can also costimulate T cell responses via HVEM, which is constitutively expressed in most lymphocyte subpopulations, including CD4+and CD8+T cells. In addition, TNFSF14 / LIGHT / CD258 has been shown to suppress tumor formation in vivo and to induce tumor cell apoptosis via the up-regulation of intercellular adhesion molecule 1 and an increased lymphocyte adhesion to cancer cells. Thus, TNFSF14 / LIGHT / CD258 is being actively investigated as a possible basis for cancer treatment.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF14 at 2 μg/mL (100 μL/well) can bind Mouse HVEM with a linear range of 0.02-0.89 μg/mL.
Source: HEK293 cells
Tag: N-his
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGAL VVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSS SRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only