WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TNFSF15/TL1 Protein - RP00053

Recombinant Human TNFSF15/TL1 Protein - RP00053

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human TNFSF15/TL1 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP00053-10, RP00053-20, RP00053-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF15/TL1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Leu72-Leu251) of human TL1A/TNFSF15 (Accession #NP_005109.2) fused with an initial Met at the N-terminus.

Alternate Names: TNFSF15, TL1, TL1A, TNLG1B, VEGI, VEGI192A

SWISS: O95150

GeneID: 9966

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 Protein at 5 μg/mL (100 μL/well) can bind DCR3 with a linear range of 0.12-6.98 ng/mL.|2.Measured by its ability to induce apoptosis of TF‑1 human erythroleukemic cells. The ED50 for this effect is 52.1-208.5 ng/mL, corresponding to a specific activity of 4.79×10^3 ~1.92×10^4 units/mg.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 50mM NaCl, 5% glycerol, pH 8.0.Contact us for customized product form or formulation.

Antigen Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only