Skip to product information
1 of 1

ABclonal

Recombinant Human TNFSF18/GITR Ligand Protein - RP01433

Recombinant Human TNFSF18/GITR Ligand Protein - RP01433

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TNFSF18/GITR Ligand Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01433-10, RP01433-20, RP01433-50, RP01433-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF18/GITR Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln50-Ser177) of human GITR Ligand/TNFSF18 (Accession #NP_005083.3) fused with a 6×His tag at the C-terminus.

Alternate Names: TNFSF18, AITRL, GITRL, TL6, TNLG2A, hGITRL

SWISS: Q9UNG2

GeneID: 8995

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human TNFSF18 at 10 μg/mL (100 μL/well) can bind Human TNFRSF18 with a linear range of 0.8-14.5 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details