ABclonal
Recombinant Human TNFSF18/GITR Ligand Protein - RP01535
Recombinant Human TNFSF18/GITR Ligand Protein - RP01535
Couldn't load pickup availability
Recombinant Human TNFSF18/GITR Ligand Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01535-10, RP01535-20, RP01535-50, RP01535-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFSF18/GITR Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln50-Ser177) of human GITR Ligand/TNFSF18 (Accession #NP_005083.2) fused with a hFc tag at the C-terminus.
Alternate Names: TNFSF18, AITRL, GITRL, TL6, TNLG2A, hGITRL
SWISS: Q9UNG2
GeneID: 8995
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
