WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TNFSF4/OX40 ligand/CD252 Protein - RP01902

Recombinant Human TNFSF4/OX40 ligand/CD252 Protein - RP01902

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human TNFSF4/OX40 ligand/CD252 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01902-10, RP01902-20, RP01902-50, RP01902-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF4/OX40 ligand/CD252 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln51-Leu183) of Human TNFSF4/OX40 ligand/CD252 (Accession #NP_003317.1) fused with a hFc tag at the N-terminus.

Alternate Names: CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1, TNFSF4

SWISS: P23510

GeneID: 7292

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein belongs a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.

Source: HEK293 cells

Tag: N-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only