ABclonal
Recombinant Human TNFSF6/FAS ligand/CD178 Protein - RP02353
Recombinant Human TNFSF6/FAS ligand/CD178 Protein - RP02353
Couldn't load pickup availability
Recombinant Human TNFSF6/FAS ligand/CD178 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP02353-20, RP02353-50, RP02353-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFSF6/FAS ligand/CD178 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Pro134-Leu281) of Human Fas Ligand(monomer) fused with a His tag at the N-terminal.
Alternate Names: FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A, Fas ligand, FasL, FasLG
SWISS: P48023
GeneID: 356
Species: Human
Purity: ≥ 95 % as determined by Tris-Bis PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to induce apoptosis of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 2.075-8.3 ng/mL in the presence of 10 µg/mL of a cross-linking antibody Rabbit Anti-poly Histidine Monoclonal Antibody (Catalog # AE086), corresponding to a specific activity of 1.20×10^5 ~4.82×10^5 units/mg.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
