WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein - RP01129

Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein - RP01129

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01129-10, RP01129-20, RP01129-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of human CD70 (Accession #NP_001243.1) fused with an Fc tag at the N-terminus.

Alternate Names: CD70, CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A, CD27-L, CD27LG, TNFSF7, TNLG8A

SWISS: P32970

GeneID: 970

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.

Source: HEK293 cells

Tag: N-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only