Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Sizes: 10ug, 20ug
Catalogue Number: RP01720-10, RP01720-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of human CD70/TNFSF7/CD27 Ligand (Accession #NP_001243.1) fused with and a 6×His tag at the N-terminus.
Alternate Names: CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70
SWISS: P32970
GeneID: 970
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD70, a member of the tumor necrosis factor superfamily, is restricted to activated T-and B-lymphocytes and mature dendritic cells. Binding of CD70 to its receptor, CD27, is important in priming, effector functions, differentiation and memory formation of T-cells as well as plasma and memory B-cell generation. Tight control of CD70 expression is required to prevent lethal immunodeficiency. By selective transcription, CD70 is largely confined to activated lymphocytes and dendritic cells (DC). As a type II transmembrane receptor, CD70 is normally expressed on a subset of B, T and NK cells, where it plays a costimulatory role in immune cell activation. Immunohistochemical analysis of CD70 expression in multiple carcinoma types. The restricted expression pattern of CD70 in normal tissues and its widespread expression in various malignancies makes it an attractive target for antibody-based therapeutics. Investigations to exploit CD70 as a cancer target have lead to the identification of potential antibody-based clinical candidates.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human TNFSF7 (Catalog: RP01720) at 2 μg/mL (100 μL/well) can bind Human TNFRSF7 (Catalog: RP01358) with a linear range of 0.2-82 ng/mL.
Source: HEK293 cells
Tag: N-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only