Skip to product information
1 of 2

Elabscience

Recombinant Human TPO protein(N-His)(active) - PKSH034168

Recombinant Human TPO protein(N-His)(active) - PKSH034168

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TPO protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSH034168-20, PKSH034168-100 Citations, Manuals and MSDS Available upon request. Abbreviation: TPO Target Symptom: Megakaryocyte colony-stimulating factor; c-MPL Ligand; MGDF Target Species: Human Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P40225 Accession: P40225 Background: Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. Activity: Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant human TPO is > 5 x 105IU/mg. Sequence: MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG Purity: > 95 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.01 EU per μg of the protein as determined by the LAL method. Calculated MW: 38.65 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details