ABclonal
Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein - RP00606
Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein - RP00606
Couldn't load pickup availability
Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00606-10, RP00606-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ile154) of Human Transcriptional Repressor Ctcf/CTCF (Accession #P49711)fused with no tag..
Alternate Names: CTCF, MRD21, CCCTC-binding factor, MRD21, CTCF
SWISS: P49711
GeneID: 10664
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Transcriptional Repressor CTCF (CTCF) belongs to the CTCF Zinc-Finger Protein family. CTCF contains twelveC2H2-type zinc fingers and interacts with CHD8. CTCF is widely expressed in many tissues, and it is absent inprimary spermatocytes. CTCF is involved in transcriptional regulation by binding to chromatin insulators andpreventing interaction between promoter and nearby enhancers and silencers. CTCF plays an essential role inoocyte and preimplantation embryo development by activating or repressing transcription. In addition, CTCF isalso indispensable in the epigenetic regulation and chromatin remodeling.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4Contact us for customized product form or formulation.
Antigen Sequence: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
