Skip to product information
1 of 1

ABclonal

Recombinant Human TREM-1/CD354 Protein - RP00168

Recombinant Human TREM-1/CD354 Protein - RP00168

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TREM-1/CD354 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP00168-10, RP00168-20, RP00168-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TREM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Arg200) of human TREM1 (Accession #NP_061113.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: TREM1, CD354, TREM-1

SWISS: Q9NP99

GeneID: 54210

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: TREM1 (triggering receptor expressed on myeloid cells) is a type I transmembrane protein with a single Ig-like domain, and is selectively expressed on blood neutrophils and a subset of monocytes. As a member of the growing family of receptors related to NK cell receptors, TREM1 activates downstream signaling events with the help of an adapter protein called DAP12. T TREM1 amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details