ABclonal
Recombinant Human TREM2 Protein - RP01159
Recombinant Human TREM2 Protein - RP01159
Couldn't load pickup availability
Recombinant Human TREM2 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01159-10, RP01159-20, RP01159-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of human TREM-2 (Accession #NP_061838) fused with a 6×His tag at the C-terminus.
Alternate Names: PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c, TREM2, TREM-2, Trem2a, Trem2b, Trem2c
SWISS: Q9NZC2
GeneID: 54209
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human TREM2 at 1μg/mL (100 μL/well) can bind TREM2 Rabbit pAb with a linear range of 0.06-1.86 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
