Skip to product information
1 of 1

ABclonal

Recombinant Human TREM2 Protein - RP01159

Recombinant Human TREM2 Protein - RP01159

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TREM2 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01159-10, RP01159-20, RP01159-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of human TREM-2 (Accession #NP_061838) fused with a 6×His tag at the C-terminus.

Alternate Names: PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c, TREM2, TREM-2, Trem2a, Trem2b, Trem2c

SWISS: Q9NZC2

GeneID: 54209

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human TREM2 at 1μg/mL (100 μL/well) can bind TREM2 Rabbit pAb with a linear range of 0.06-1.86 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details