Skip to product information
1 of 1

ABclonal

Recombinant Human TROP-2/TACSTD2 Protein - RP01048

Recombinant Human TROP-2/TACSTD2 Protein - RP01048

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TROP-2/TACSTD2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01048-10, RP01048-20, RP01048-50, RP01048-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr88-Thr274) of human TROP-2 (Accession #NP_002344.2) fused with a 6×His tag at the C-terminus.

Alternate Names: TACSTD2, EGP-1, EGP1, GA733-1, GA7331, GP50, M1S1, TROP2

SWISS: P09758-1

GeneID: 4070

Species: Human

Purity: ≥ 85% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TACSTD2 (Catalog: RP01048) at 1 μg/mL (100 μL/well) can bind TROP-2 Rabbit mAb (Catalog: A24170) with a linear range of 0.128-0.85 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.Contact us for customized product form or formulation.

Antigen Sequence: TLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details