Skip to product information
1 of 1

ABclonal

Recombinant Human TSLP Protein - RP01171

Recombinant Human TSLP Protein - RP01171

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TSLP Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01171-10, RP01171-20, RP01171-50, RP01171-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TSLP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr29-Gln159) of human TSLP (Accession #NP_149024.1) fused with a 6×His tag at the C-terminus.

Alternate Names: TSLP

SWISS: Q969D9-1

GeneID: 85480

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details