Skip to product information
1 of 1

ABclonal

Recombinant Human TUBB4A Protein - RP02833

Recombinant Human TUBB4A Protein - RP02833

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human TUBB4A Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02833-10, RP02833-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TUBB4A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala444) of human TUBB4A (Accession #NP_006078.2) fused with a 6×His tag at the N-terminus.

Alternate Names: Tubulin Beta-4A Chain; Tubulin 5 Beta; Tubulin Beta-4 Chain; TUBB4A; TUBB4; TUBB5

SWISS: P04350

GeneID: 10382

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tubulin Beta-4A Chain (TUBB4A) is a cytoplasmic peptide containing 444 amino acids. TUBB4A is a member of the Tubulin family. Tubulin is the major constituent of microtubules. Tubulin is a dimer composed of one alpha and one beta tubulin molecule; there are many forms of beta tubulins, Beta II and Beta IV Tubulin are ubiquitously expressed. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Source: E. coli

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris-HCl, 50mM NaCl, 2M Urea, pH8.0.

Antigen Sequence: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details