Recombinant Human TWSG1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01049-10, RP01049-20, RP01049-50, RP01049-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TWSG1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Phe223) of human TWSG1 (Accession #NP_065699.1) fused with a 6×His tag at the C-terminus.
Alternate Names: TSG, TSGtwisted gastrulation protein homolog 1, TWSG1, TWSG1
SWISS: Q9GZX9
GeneID: 57045
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only