ABclonal
Recombinant Human UBE2D3 Protein - RP00012
Recombinant Human UBE2D3 Protein - RP00012
Couldn't load pickup availability
Recombinant Human UBE2D3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00012-10, RP00012-20, RP00012-50, RP00012-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human UBE2D3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met147) of human UBE2D3 (Accession #NP_003331.1) fused with a 6×His tag at the C-terminus.
Alternate Names: UBE2D3, E2(17)KB3, UBC4/5, UBCH5C
SWISS: P61077
GeneID: 7323
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
