Skip to product information
1 of 1

ABclonal

Recombinant Human uPA/PLAU Protein - RP00146LQ

Recombinant Human uPA/PLAU Protein - RP00146LQ

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human uPA/PLAU Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00146LQ-10, RP00146LQ-20, RP00146LQ-50, RP00146LQ-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Leu431) of human Urokinase/PLAU (Accession #NP_002649.1) fused with a 8×His tag at the C-terminus.

Alternate Names: PLAU, ATF, BDPLT5, QPD, UPA, URK, u-PA, urokinase

SWISS: P00749

GeneID: 5328

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Background: Plasminogen activator, urokinase, also known as PLAU and uPA, is a serine protease which converts plasminogen to plasmin, a broad-spectrum protease active on extracellular matrix (ECM) components. It is involved in complement activation, cell migration, wound healing, and generation of localized extracellular proteolysis during tissue remodelling, pro-hormone conversion, carcinogenesis and neoplasia. uPA and its receptor (uPAR) have been implicated in a broad spectrum of pathophysiological processes, including fibrinolysis, proteolysis, inflammation, atherogenesis and plaque destabilization, all of which are involved in the pathogenesis of MI (myocardial infarction). The role of uPA is not only does it as a kind of enzyme, but also is breast cancer, stomach cancer, colon cancer, bladder cancer, ovarian cancer, brain, and endometrial cancer markers for a strong invasion and metastasis.Because of the causal involvment of uPA in cancer invasion and metastasis, the blockade of uPA interactions and activity with specific inhibitors is of interest for novel strategies in cancer therapy.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human uPAR Protein at 1 μg/mL (100 μL/well) can bind PLAU with a linear range of 0.031-1.014 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Supplied as a 0.22 μm filtered solution in 20mM HEPES, 150mM NaCl, 2mM CaCl, 10% Glycerol, pH 7.5Contact us for customized product form or formulation.

Antigen Sequence: MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details