Skip to product information
1 of 1

ABclonal

Recombinant Human VEGF-A/VEGF121 Protein - RP01162

Recombinant Human VEGF-A/VEGF121 Protein - RP01162

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human VEGF-A/VEGF121 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01162-10, RP01162-20, RP01162-50, RP01162-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human VEGF-A/VEGF121 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg147) of human VEGF121 (Accession #NP_001165099.1) fused with a 6×His tag at the N-terminus.

Alternate Names: VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A, MVCD1, VEGF, VPF, L VEGFA, VEGF A

SWISS: P15692-9

GeneID: 7422

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF121 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 4-10 ng/mL.|2.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 0.09-0.36 ng/mL.|3.Recombinant Human VEGFA(40 ng/mL) and bFGF(50 ng/mL, Cat. RP01162) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells. After 4 days induction, pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details