ABclonal
Recombinant Human VEGF-A/VEGF121(K321N) Protein - RP00017
Recombinant Human VEGF-A/VEGF121(K321N) Protein - RP00017
Couldn't load pickup availability
Recombinant Human VEGF-A/VEGF121(K321N) Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00017-10, RP00017-20, RP00017-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human VEGF-A/VEGF121(K321N) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala207-Arg327 (Lys321Asn)) of human VEGF121 (Accession #NP_001020541.2).
Alternate Names: VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A, MVCD1, VEGF, VPF, L VEGFA, VEGF A
SWISS: P15692
GeneID: 7422
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human VEGF121 at 2 μg/mL (100 μL/well) can bind Human KDR with a linear range of 0.2-10 ng/mL.|2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 0.017-0.068 ng/mL, corresponding to a specific activity of 1.47 ×10^7-5.88 ×10^7units/mg.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
