ABclonal
Recombinant Human VEGF-A/VEGF165 Protein - RP01150
Recombinant Human VEGF-A/VEGF165 Protein - RP01150
Couldn't load pickup availability
Recombinant Human VEGF-A/VEGF165 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01150-10, RP01150-20, RP01150-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human VEGF-A/VEGF165 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg191) of human VEGF165 (Accession #NP_001165097.1) fused with a 6×His tag at the N-terminus.
Alternate Names: VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A, MVCD1, VEGF, VPF, L VEGFA, VEGF A
SWISS: P15692-4
GeneID: 7422
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF165 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 8-20 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human VEGF165 at 2 μg/mL (100 μL/well) can bind Human KDR with a linear range of 0.2-11.6 ng/mL.|3.Recombinant Human VEGF165 stimulates cell proliferation of the human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 0.19-0.78 ng/mL, corresponding to a specific activity of 1.28 × 106~5.26× 106 units/mg.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
