ABclonal
Recombinant Human VEGF-D/FIGF Protein - RP01426
Recombinant Human VEGF-D/FIGF Protein - RP01426
Couldn't load pickup availability
Recombinant Human VEGF-D/FIGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01426-10, RP01426-20, RP01426-50, RP01426-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human VEGF-D/FIGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe93-Ser201) of human VEGF-D/FIGF (Accession #NP_004460.1) fused with a 6×His tag at the C-terminus.
Alternate Names: VEGFD, FIGF, VEGF-D, vascular endothelial growth factor D, FIGF, VEGF-D
SWISS: O43915
GeneID: 2277
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Vascular endothelial growth factor D (VEGF-D), also known as C-fos induced growth factor (FIGF), belongs to the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. FIGF protein is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. FIGF protein is secreted as a non-covelent homodimer in an antiparallel fashion. Human FIGF protein is expressed in adult lung, heart, muscle, and small intestine, and is most abundantly expressed in fetal lungs and skin. FIGF protein is structurally and functionally similar to VEGF-C. Therefore, FIGF protein binds and activates VEGFR-2 (Flk1) and VEGFR-3 (Flt4) receptors, and may particularly be involved in cancers, such as breast cancer, epithelial ovarian carcinoma and so on.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FIGF/VEGF-D at 1 μg/mL (100 μL/well) can bind Human VEGFR3 with a linear range of 1.953-100.773 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
