ABclonal
Recombinant Human Vitronectin/V75/VTN Protein - RP01385
Recombinant Human Vitronectin/V75/VTN Protein - RP01385
Couldn't load pickup availability
Recombinant Human Vitronectin/V75/VTN Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01385-20, RP01385-50, RP01385-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Vitronectin/V75/VTN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp20-Leu478) of human Vitronectin/VTN (Accession #NP_000629.3) fused with a 6×His tag at the C-terminus.
Alternate Names: V75, VN, VNT, VTN, VN, VNT
SWISS: P04004
GeneID: 7448
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Vitronectin, also known as VTN, is a member of the pexin family. It is an abundant glycoprotein found in serum the extracellular matrix and promotes cell adhesion and spreading. Vitronectin is a secreted protein and exists in either a single chain form or a cleaved, two chain form held together by a disulfide bond. Vitronectin is a plasma glycoprotein implicated as a regulator of diverse physiological process, including blood coagulation, fibrinolysis, pericellular proteolysis, complement dependent immune responses, and cell attachment and spreading. Because of its ability to bind platelet glycoproteins and mediate platelet adhesion and aggregation at sites of vascular injury, vitronectin has become an important mediator in the pathogenesis of coronary atherosclerosis. As a multifunctional protein with a multiple binding domain, Vitronectin interacts with a variety of plasma and cell proteins. Vitronectin binds multiple ligands, including the soluble vitronectin receptor. It may be an independent predictor of adverse cardiovascular outcomes following acute stenting. Accordingly, Vitronectin is suggested to be involved in hemostasis, cell migration, as well as tumor malignancy.
Bio-Activity: Measured by the ability of the immobilized protein to support the adhesion of B16‑F1 mouse melanoma cells. When 5×10^4 cells/well are added to Vitronectin coated plates (5 µg/mL with 100 µL/well), approximately >85% will adhere after 30 minutes at 37 °C.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
