Skip to product information
1 of 1

ABclonal

Recombinant Human Vitronectin/V75/VTN Protein - RP01385

Recombinant Human Vitronectin/V75/VTN Protein - RP01385

Regular price $154.00 CAD
Regular price Sale price $154.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Vitronectin/V75/VTN Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01385-20, RP01385-50, RP01385-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Vitronectin/V75/VTN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp20-Leu478) of human Vitronectin/VTN (Accession #NP_000629.3) fused with a 6×His tag at the C-terminus.

Alternate Names: V75, VN, VNT, VTN, VN, VNT

SWISS: P04004

GeneID: 7448

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Vitronectin, also known as VTN, is a member of the pexin family. It is an abundant glycoprotein found in serum the extracellular matrix and promotes cell adhesion and spreading. Vitronectin is a secreted protein and exists in either a single chain form or a cleaved, two chain form held together by a disulfide bond. Vitronectin is a plasma glycoprotein implicated as a regulator of diverse physiological process, including blood coagulation, fibrinolysis, pericellular proteolysis, complement dependent immune responses, and cell attachment and spreading. Because of its ability to bind platelet glycoproteins and mediate platelet adhesion and aggregation at sites of vascular injury, vitronectin has become an important mediator in the pathogenesis of coronary atherosclerosis. As a multifunctional protein with a multiple binding domain, Vitronectin interacts with a variety of plasma and cell proteins. Vitronectin binds multiple ligands, including the soluble vitronectin receptor. It may be an independent predictor of adverse cardiovascular outcomes following acute stenting. Accordingly, Vitronectin is suggested to be involved in hemostasis, cell migration, as well as tumor malignancy.

Bio-Activity: Measured by the ability of the immobilized protein to support the adhesion of B16‑F1 mouse melanoma cells. When 5×10^4 cells/well are added to Vitronectin coated plates (5 µg/mL with 100 µL/well), approximately >85% will adhere after 30 minutes at 37 °C.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details