ABclonal
Recombinant Human VSIG3/IgSF11 Protein - RP01410
Recombinant Human VSIG3/IgSF11 Protein - RP01410
Couldn't load pickup availability
Recombinant Human VSIG3/IgSF11 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01410-10, RP01410-20, RP01410-50, RP01410-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human VSIG3/IgSF11 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Gly241) of human VSIG3/IGSF11 (Accession #NP_001015887.1) fused with a 6×His tag at the C-terminus.
Alternate Names: BT-IgSF, CT119, CXADRL1, Igsf13, VSIG3, IGSF11
SWISS: Q5DX21-1
GeneID: 152404
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Immunoglobulin superfamily member 11(IGSF11) is expressed on the plasma membrane in the testis and brain. These IGSF proteins undergo final modifications during capacitation and/or the acrosome reaction. IGSF proteins share significant homology with endothelial cell-selective adhesion molecule and coxsackievirus and adenovirus receptor, which mediates cell attachment and homotypic intercellular interactions. In clinical, the IGSF11 has been reported to overexpressed in colorectal cancers and hepatocellular carcinomas, as well as intestinal-type gastric cancers, compared to their corresponding non-cancerous tissues. The IGSF11 has also been found expressed abundantly in the testis and ovary and the IGSF11 can be used as a candidate of cancer-testis antigen.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
