Skip to product information
1 of 1

ABclonal

Recombinant Human VSIG8 Protein - RP02169

Recombinant Human VSIG8 Protein - RP02169

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human VSIG8 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02169-10, RP02169-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human VSIG8 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Val22-Gly263) of human VSIG8 (Accession #Q5VU13) fused with a 6xHis tag at the C- terminus.

Alternate Names: VSIG8, C1orf204, VSIG8

SWISS: Q5VU13

GeneID: 391123

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details