Recombinant Human VSIG8 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02169-10, RP02169-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human VSIG8 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Val22-Gly263) of human VSIG8 (Accession #Q5VU13) fused with a 6xHis tag at the C- terminus.
Alternate Names: VSIG8, C1orf204, VSIG8
SWISS: Q5VU13
GeneID: 391123
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only