Skip to product information
1 of 1

ABclonal

Recombinant Human WAP5/WFDC2/HE4 Protein - RP00132

Recombinant Human WAP5/WFDC2/HE4 Protein - RP00132

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human WAP5/WFDC2/HE4 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00132-10, RP00132-20, RP00132-50, RP00132-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human WAP5/WFDC2/HE4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu31-Phe124) of human WAP5/WFDC2/HE4 (Accession #NP_006094.3) fused with a 6×His tag at the C-terminus.

Alternate Names: EDDM4, HE4, WAP5, dJ461P17.6, WFDC2, HE4, WAP5, dJ461P17.6

SWISS: Q14508

GeneID: 10406

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details