Skip to product information
1 of 1

BioWorld

Recombinant IL-1α, Rat - BK0237

Recombinant IL-1α, Rat - BK0237

Regular price $375.54 CAD
Regular price Sale price $375.54 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant IL-1α, Rat

Catalogue Numbers: BK0237-10, BK0237-50

Sizes: 10μg, 50μg

Source: CHO

Molecular Weight: 17~22 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 <5 pg/ml, measured in a proliferation assay using D10S cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF
VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.

View full details