Skip to product information
1 of 1

BioWorld

Recombinant IL-12, Human (HEK293-expressed) - BK0312

Recombinant IL-12, Human (HEK293-expressed) - BK0312

Regular price $256.94 CAD
Regular price Sale price $256.94 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant IL-12, Human (HEK293-expre Ssed)

Catalogue Numbers: BK0312-5, BK0312-25

Sizes: 5μg, 25μg

Source: HEK 293

Molecular Weight: Approximately 75 kDa, consisting of a 306 amino acid residue p40 subunit and a 197 amino acid residue p35 subunit.

Purity: > 95% as analyzed by SDS-PAGE and HPLC.

Biological Activity: EC50 < 2 ng/ml, measured by the induction of IFN-γ from NK cells co-stimulated with IL-18, corresponding to a specific activity of > 1×10ˆ6 units/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTS
t VEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNML
AVIDELMQALNFNSEt VPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
p40:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK
EFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSR
GSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSAt VICRKNASISVRAQDRYYSSSWS
EWASVPCS

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Human Interleukin 12(IL-12) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh-IL12 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Interleukin 12 (IL-12), also known as natural killer cell stimulatory factor (NKSF) or cytotoxic lymphocyte maturation factor (CLMF), is a pleiotropic cytokine originally identified in the medium of activated human B lymphoblastoid cell lines. The p40 subunit of IL-12 has been shown to have extensive amino acid sequence homology to the extracellular domain of the human IL-6 receptor while the p35 subunit shows distant but significant sequence similarity to IL-6, G-CSF, and chicken MGF. These observations have led to the suggestion that IL-12 might have evolved from a cytokine/soluble receptor complex. Human and mouse IL-12 share 70% and 60% amino acid sequence homology in their p40 and p35 subunits, respectively. IL-12 apparently shows species specificity with human IL-12 reportedly showing minimal activity in the mouse system.

View full details