Skip to product information
1 of 1

BioWorld

Recombinant IL-1RA, Human (HEK293-expressed) - BK0310

Recombinant IL-1RA, Human (HEK293-expressed) - BK0310

Regular price $217.41 CAD
Regular price Sale price $217.41 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant IL-1RA, Human (HEK293-expre Ssed)

Catalogue Numbers: BK0310-10, BK0310-50

Sizes: 10μg, 50μg

Source: HEK 293

Molecular Weight: 18-23 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE and HPLC.

Biological Activity: ED50 < 0.1 μg /ml, measured in a neutralization assay using D10S cells in the presence of 50pg/ml Human IL-1a.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL
EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant human IL-1 Receptor Antagonist remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-1 Receptor Antagonist should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL-1alpha and IL-1beta, and modulates a variety of IL-1 related immune and inflammatory responses. It inhibits the activity of IL-1 by binding to the receptor IL-1R1 and preventing its association with the coreceptor IL-1RAP for signaling. Clinical studies are being conducted to investigate the use of IL-1RA in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia.

View full details