Skip to product information
1 of 1

BioWorld

Recombinant IL-4, His, Rat - BK0244

Recombinant IL-4, His, Rat - BK0244

Regular price $217.41 CAD
Regular price Sale price $217.41 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant IL-4, His, Rat

Catalogue Numbers: BK0244-5, BK0244-25

Sizes: 5μg, 25μg

Source: CHO

Molecular Weight: 18-22 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC
RGVSGLNSLRSCt VNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.

View full details