Recombinant IL-5, Mouse (CHO-expre Ssed)
Catalogue Numbers: BK0250-10, BK0250-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 25-40 kDa, observed by non-reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity: ED50 < 0.5 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 2×10ˆ6 units/mg.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: MEIPMSt VVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQt VRGGt VEMLFQNLSLIKKYIDRQ
KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Murine Interlerkin 5 (IL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Murine IL-5 is homodimeric protein with molecular weight ranging from 25 to 40 kDa due to glycosylation.