WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant IL-5, Rat(CHO-expressed) - BK0251

Recombinant IL-5, Rat(CHO-expressed) - BK0251

Regular price
$375.54
Regular price
Sale price
$375.54
Unit price
per 
Availability
Sold out

Recombinant IL-5, Rat(CHO-expre Ssed)

Catalogue Numbers: BK0251-10, BK0251-50

Sizes: 10μg, 50μg

Source: CHO

Molecular Weight: 13~21 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 < 0.5 ng/ml, measured in a proliferation assay using TF-1 Cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: MEIPMSt VVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQt VRGGt VEILFQNLSLIKKYIDGQ
KEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Rat Interleukin-5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.