Recombinant IL-7, His, Mouse
Catalogue Numbers: BK0256-10, BK0256-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 8-28kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE.
Biological Activity: ED50<0.4ng/ml, measured in a cell proliferation assay using 2E8 cells.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLN
RAARKLKQFLKMNISEEFNVHLLt VSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH
Endotoxin: <0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor,a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.