Skip to product information
1 of 1

BioWorld

Recombinant LIX/CXCL5(88aa), Rat - BK0263

Recombinant LIX/CXCL5(88aa), Rat - BK0263

Regular price $217.41 CAD
Regular price Sale price $217.41 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant LIX/CXCL5(88aa), Rat

Catalogue Numbers: BK0263-10, BK0263-50

Sizes: 10μg, 50μg

Source: CHO

Molecular Weight: 9.6 kDa, observed by reducing SDS-PAGE.

Purity: > 98% as analyzed by SDS-PAGE.

Biological Activity: The EC50 value of rat LIX/CXCL5 (88aa) on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human Ga15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 3 μg/ml.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQK
ILGSENKKTKRNALALVR

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Rat LIX/CXCL5(88aa) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat LIX/CXCL5(88aa) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: LPSinduced CXC chemokine (LIX), also known as C-X-C motif chemokine 5(CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Rat LIX cDNA encodes a 130 aa residue precursor with a predicted 37 aa residue signal peptide and a 93 aa residue mature protein. Among human CXC chemokines, rat LIX is most closely related to human GCP-2 and ENA-78.LIX can signal through the CXCR2 receptor.Recombinant rat LIX/CXCL5 (88aa) produced in CHO cells is a polypeptide chain containing 88 amino acids. A fully biologically active molecule, rrLIX/CXCL5 (88aa) has a molecular mass of 9.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

View full details