ABclonal
Recombinant Monkeypox virus A30L Protein - RP01593
Recombinant Monkeypox virus A30L Protein - RP01593
Couldn't load pickup availability
Recombinant Monkeypox virus A30L Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01593-10, RP01593-20, RP01593-50, RP01593-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Monkeypox virus A30L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Leu146) of monkeypox virus A30L (Accession #NP_536567.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Envelope protein A28 homolog, Protein A30, A30L
SWISS: Q8V4U9
GeneID: 928965
Species: Monkeypox virus
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
