ABclonal
Recombinant Monkeypox virus D6L Protein - RP01606
Recombinant Monkeypox virus D6L Protein - RP01606
Couldn't load pickup availability
Recombinant Monkeypox virus D6L Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01606-10, RP01606-20, RP01606-50, RP01606-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Monkeypox virus D6L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val21-Lys126) of monkeypox virus D6L (Accession #Q5QC89) fused with a 6×His tag at the C-terminus.
Alternate Names: IL-18 binding protein; COP-009; D6L
SWISS: Q5QC89
GeneID: 929030
Species: Monkeypox virus
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
