Recombinant Monkeypox virus L1R Protein - RP01544

Recombinant Monkeypox virus L1R Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01544-10, RP01544-20, RP01544-50, RP01544-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Monkeypox virus L1R Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys152) of L1R (Accession #URK20522.1) fused with a 6×His tag at the C-terminus.

Alternate Names: L1R, L1R

SWISS: Q8V4Z7

GeneID: 928938

Species: Monkeypox virus

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only