ABclonal
Recombinant Mouse Apolipoprotein A-I/APOA1 Protein - RP01463
Recombinant Mouse Apolipoprotein A-I/APOA1 Protein - RP01463
Couldn't load pickup availability
Recombinant Mouse Apolipoprotein A-I/APOA1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01463-10, RP01463-20, RP01463-50, RP01463-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Apolipoprotein A-I/APOA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp25-Gln264) of mouse ApoA-I/APOA1 (Accession #NP_033822.2) fused with a hFc tag at the C-terminus.
Alternate Names: Sep2, Alp-1, Ltw-1, Sep-1, Sep-2, Apoa-1, Brp-14, Lvtw-1, apo-AI, apoA-I, APOA1
SWISS: Q00623
GeneID: 11806
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Apolipoprotein A1 (APOA1) is a member of the apolipoprotein family whose members are proteins bind with lipids and form lipoproteins to translate these oil-soluble lipids such as fat and cholesterol through lymphatic and circulatory system. APOA1 is the main component of high density lipoprotein (HDL) in plasma and is involved in the esterification of cholesterol as a cofactor of lecithin-cholesterol acyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters, and thus play a major role in cholesterol efflux from peripheral cells. As a major component of the HDL complex, APOA1 helps to clear cholesterol from arteries. APOA1 is also characterized as a prostacyclin stabilizing factor, and thus may have an anticlotting effect. Defects in encoding gene may result in HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Men carrying a mutation may develop premature coronary artery disease.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse A-I/APOA1 at 5μg/mL (100 μL/well) can bind Human MSR1/CD204 with a linear range of 1-21.4ng/mL.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
