Skip to product information
1 of 1

ABclonal

Recombinant Mouse B7-DC/PD-L2/CD273 Protein - RP01585

Recombinant Mouse B7-DC/PD-L2/CD273 Protein - RP01585

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse B7-DC/PD-L2/CD273 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01585-10, RP01585-20, RP01585-50, RP01585-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse B7-DC/PD-L2/CD273 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Arg219) of mouse B7-DC/PD-L2/CD273 (Accession #NP_067371.1) fused with a hFc tag at the C-terminus.

Alternate Names: B7-DC, B7DC, bA574F11.2, Btdc, CD273, PD-L2, PDCD1L2, PDL2, PDCD1LG2

SWISS: Q9WUL5

GeneID: 58205

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Programmed Death Ligand 2 (PD-L2), also known as B7-DC and butyrophilin-like protein, is a member of the B7 family of proteins that provide signals for regulating T-cell activation and tolerance.PD-L2 is expressed on dendritic cells, subsets of activated CD4+ and CD8+ T cells, and memory B cells that differentiate into plasma cells. At inflammatory sites such as rheumatoid arthritis, allergen exposure, and virus infection, PD-L2 is up-regulated on synoviocytes, infiltrating macrophages, dendritic cells, and airway epithelial cells. PD-L2, along with B7-H1/PD-L1, binds to T cell PD-1 where it promotes IFN-gamma production and CD40 Ligand up-regulation while inhibiting IL-4 production. In addition, PD-L2 binds to RGM-B on macrophages and alveolar epithelial cells, supporting respiratory immune tolerance. In asthma, PD-L2 suppresses IL-5 and IL-13 production, promotes IL-12 production by dendritic cells, and supports allergen-induced airway hyper-responsiveness and mucus production.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 (Catalog: RP01585) at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse PD-1 with a linear range of 19.5-622 ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details