Skip to product information
1 of 1

ABclonal

Recombinant Mouse Basigin/EMMPRIN/CD147 Protein - RP01467

Recombinant Mouse Basigin/EMMPRIN/CD147 Protein - RP01467

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Basigin/EMMPRIN/CD147 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01467-10, RP01467-20, RP01467-50, RP01467-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Basigin/EMMPRIN/CD147 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Ala211) of mouse CD147/EMMPRIN/Basigin (Accession #NP_033898.1) fused with a 6×His, Avi tag at the C-terminus.

Alternate Names: CD147

SWISS: P18572-2

GeneID: 12215

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.

Source: HEK293 cells

Tag: C-His&Avi

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AAGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details