ABclonal
Recombinant Mouse BTLA/CD272 Protein - RP01620
Recombinant Mouse BTLA/CD272 Protein - RP01620
Couldn't load pickup availability
Recombinant Mouse BTLA/CD272 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01620-10, RP01620-20, RP01620-50, RP01620-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse BTLA/CD272 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu30-Pro176) of mouse BTLA (Accession #NP_001032808.2) fused with a hFc tag at the C-terminus.
Alternate Names: CD272; BTLA; BTLA1; FLJ16065; MGC129743, BTLA
SWISS: Q7TSA3
GeneID: 208154
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: B- and T-lymphocyte attenuator (BTLA; CD272) is a 35 kDa type I transmembrane glycoprotein in the CD28 family of T cell costimulatory molecules. BTLA is a inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. BTLA may interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: EKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
