Skip to product information
1 of 1

ABclonal

Recombinant Mouse c-Kit/CD117 Protein - RP01503

Recombinant Mouse c-Kit/CD117 Protein - RP01503

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse c-Kit/CD117 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01503-10, RP01503-20, RP01503-50, RP01503-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse c-Kit/CD117 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser25-Pro527) of mouse KIT/c-KIT/CD117 (Accession #NP_001116205.1) fused with a 6×His tag at the C-terminus.

Alternate Names: W, Bs, Fdc, Ssm, SCO1, SCO5, SOW3, CD117, c-KIT, Tr-kit, Gsfsco1, Gsfsco5, Gsfsow3, CD117

SWISS: P05532

GeneID: 16590

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details