ABclonal
Recombinant Mouse c-Kit ligand/KITLG/SCF Protein - RP01055
Recombinant Mouse c-Kit ligand/KITLG/SCF Protein - RP01055
Couldn't load pickup availability
Recombinant Mouse c-Kit ligand/KITLG/SCF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01055-10, RP01055-20, RP01055-50, RP01055-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse c-Kit ligand/KITLG/SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6×His tag at the C-terminus.
Alternate Names: KITLG, FPH2, KL-1, Kitl, MGF, SCF, SF, SHEP7, KL, SCF/KITLG
SWISS: P20826-1
GeneID: 17311
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.5-1.0 ng/mL, corresponding to a specific activity of 1.0×10^6 -2.0×10^6 units/mg.|2. Measured by its binding ability in a functional ELISA.Immobilized recombinant Mouse SCF at 2 μg/mL (100 μL/well) can bind recombinant human CD117 with a linear range of 1.5-10 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
