ABclonal
Recombinant Mouse C7orf50(Cholesin) Protein - RP01980
Recombinant Mouse C7orf50(Cholesin) Protein - RP01980
Couldn't load pickup availability
Recombinant Mouse C7orf50(Cholesin) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01980-10, RP01980-20, RP01980-50, RP01980-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse C7orf50(Cholesin) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser195) of Mouse 3110082I17Rik(Cholesin) (Accession #NP_082745.2) fused with His at the C-terminus.
Alternate Names: C7orf50, 3110082I17Rik, Cholesin, Protein C7orf50
SWISS: Q9CXL3
GeneID: 73212
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Hormone secreted from the intestine in response to cholesterol, where it acts to inhibit cholesterol synthesis in the liver and VLDL secretion,leading to a reduction in circulating cholesterol levels. Acts through binding to its receptor, GPR146.
Source: E. coli
Tag: C-6His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MAKHKRKGLEGTGKESKRQKITPAEETPRTSEAGPDKETASTLVQEASPELSPEERRVLERKLKKERKKEEKKRLREAGIAATQTAKVQTLPAKPSAATLALEYLQGWAQKQESWRFQKTRQTWLLLHMYDEDKVPDEHFPTLLDYLEGLRGSARELTVRKAEALMQKLDEAEPEDSGGSPGKVQRLRQVLQLLS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
