Skip to product information
1 of 1

ABclonal

Recombinant Mouse Cathepsin S/CTSS Protein - RP01605

Recombinant Mouse Cathepsin S/CTSS Protein - RP01605

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Cathepsin S/CTSS Protein

Sizes: 10ug, 20ug

Catalogue Number: RP01605-10, RP01605-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Cathepsin S/CTSS Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val18-Ile340) of mouse Cathepsin S/CTSS (Accession #NP_067256.4) fused with and a 6×His tag at the C-terminus.

Alternate Names: Cathepsin S; Ctss; Cats, CTSS

SWISS: O70370

GeneID: 13040

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Cathepsin S (CTSS), one of the lysosomal proteinases, has many important physiological functions in the nervous system, especially in process of extracellular matrix degradation and endocellular antigen presentation. Cathepsin S is expressed in the lysosome of antigen presenting cells, primarily dendritic cells, B-cells and macrophages. Cathepsin S is most well known for its critical function in the proteolytic digestion of the invariant chain chaperone molecules, thus controlling antigen presentation to CD4+ T-cells by major histocompatibility complex (MHC) class II molecules or to NK1.1+ T-cells via CD1 molecules. Cathepsin S also appears to participate in direct processing of exogenous antigens for presentation by MHC class II to CD4+ T-cells, or in cross-presentation by MHC class I molecules to CD8+ T-cells. In addition, it has been implicated in the pathogenesis of several diseases such as Alzheimer’s disease and degenerative disorders associated with the cells of the mononuclear phagocytic system.

Bio-Activity: Measured by its ability to cleave the fluorogenic peptide substrate, Mca-RPKPVE- Nval-WRK(Dnp)-NH2 (RD,Catalog # ES002). The specific activity is >212 pmol/ min/μg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details