ABclonal
Recombinant Mouse CCL11/Eotaxin Protein - RP01904
Recombinant Mouse CCL11/Eotaxin Protein - RP01904
Couldn't load pickup availability
Recombinant Mouse CCL11/Eotaxin Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01904-10, RP01904-20, RP01904-50, RP01904-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL11/Eotaxin Protein by Pichia expression system. The target protein is expressed with sequence (His24-Pro97) of Mouse CCL11/Eotaxin (Accession #NP_035460.1) fused with a His tag at the C-terminus..
Alternate Names: Ccl11, Scya11, Eotaxin, C-C motif chemokine 11, Eosinophil chemotactic protein, Small-inducible cytokine A11
SWISS: P48298
GeneID: 20292
Species: Mouse
Purity: ≥ 95% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CCL11 is a potent eosinophil chemoattractant that was originally purified from bronchoalveolar lavage fluid of guinea pigs sensitized by aerosol challenge with ovalbumin. Microsequencing of the purified protein revealed the guinea pig CCL11 to be a member of the beta (CC) chemokine family of inflammatory and immunoregulatory cytokines. cDNA clones for guinea pig, mouse and human CCL11 have been isolated. Mouse CCL11 cDNA encodes a 97 amino acid residue precursor protein from which the amino-terminal 23 amino acid residues are cleaved to generate the 74 amino acid residue mature mouse CCL11. At the protein sequence level, mature mouse CCL11 is approximately 60% identical to mature human and guinea pig CCL11. In addition, mouse CCL11 also shows high amino acid sequence identity to members of the MCP family. Mouse CCL11 is chemotactic for eosinophils, but not mononuclear cells or neutrophils. CCL11 mRNA is expressed in a variety of tissues. The expression of CCL11 mRNA is induced in cultured endothelial cells in response to IFN-gamma. In addition, CCL11 mRNA is also induced in response to the transplantation of IL-4-secreting tumor cells.
Source: Pichia
Tag: C-His
Formulation: Lyophilized from 0.22 μm filtered solution in PBS,250mM NaCl,pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
