Skip to product information
1 of 1

ABclonal

Recombinant Mouse CCL17/TARC Protein - RP01905

Recombinant Mouse CCL17/TARC Protein - RP01905

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CCL17/TARC Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01905-10, RP01905-20, RP01905-50, RP01905-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CCL17/TARC Protein by Pichia expression system. The target protein is expressed with sequence (Ala24-Pro93) of Mouse CCL17/TARC (Accession #NP_035462.2) fused with a His tag at the C-terminus..

Alternate Names: Ccl17, Tarc, C-C motif chemokine 17, ABCD-2, CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine

SWISS: Q9WUZ6

GeneID: 20295

Species: Mouse

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: TARC ligand (CCL17) belongs to the CC chemokine family. It is a small cytokine and the gene is located on q arm of chromosome 16, in humans, along with other chemokines. TARC specifically binds to T-cells and interacts with chemokine receptors CCR4 and CCR8. It plays an important role in T cell development in thymus as well as in trafficking and activation of mature T cells.

Source: Pichia

Tag: C-His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details