ABclonal
Recombinant Mouse CCL17/TARC Protein - RP01905
Recombinant Mouse CCL17/TARC Protein - RP01905
Couldn't load pickup availability
Recombinant Mouse CCL17/TARC Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01905-10, RP01905-20, RP01905-50, RP01905-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL17/TARC Protein by Pichia expression system. The target protein is expressed with sequence (Ala24-Pro93) of Mouse CCL17/TARC (Accession #NP_035462.2) fused with a His tag at the C-terminus..
Alternate Names: Ccl17, Tarc, C-C motif chemokine 17, ABCD-2, CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine
SWISS: Q9WUZ6
GeneID: 20295
Species: Mouse
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: TARC ligand (CCL17) belongs to the CC chemokine family. It is a small cytokine and the gene is located on q arm of chromosome 16, in humans, along with other chemokines. TARC specifically binds to T-cells and interacts with chemokine receptors CCR4 and CCR8. It plays an important role in T cell development in thymus as well as in trafficking and activation of mature T cells.
Source: Pichia
Tag: C-His
Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
