Recombinant Mouse CCL2/MCP-1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01626-10, RP01626-20, RP01626-50, RP01626-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL2/MCP-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln 24-Asn148) of mouse CCL2/MCP-1 (Accession #NP_035463.1) fused with no additional amino acid.
Alternate Names: C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF, CCL2
SWISS: P10148
GeneID: 20296
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Monocyte chemoattractant protein 1 (MCP-1), also called CCL2, belongs to a group of CC chemokines located in chromosome 17q11.2. MCP-1 protein interacts with chemokine C-C motif receptor 2 (CCR2) to activate and recruit monocytes, macrophages, CD4+ T cells and immature dendritic cells to the site of infection. The presence of MCP-1 protein in an adequate concentration is important for granuloma formation and M. tuberculosis clearance.
Bio-Activity: 1.Measured by the ability to inhibit the proliferation of HUVEC(Human Umbilical Vein Endothelial Cells).The ED50 for this effect is 0.20-0.80 ng/mL.|2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is typically 2.87-11.48 ng/mL.
Source: Pichia
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only