Recombinant Mouse CCL21/6Ckine Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01885-10, RP01885-20, RP01885-50, RP01885-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL21A Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Gly133) of Mouse CCL21A (Accession #P84444) fused with a His tag at the C-terminus.
Alternate Names: C-C Motif Chemokine 21a; 6Ckine; Beta-Chemokine Exodus-2; Small-Inducible Cytokine A21a; Thymus-Derived Chemotactic Agent 4; TCA4; Ccl21a; Scya21; Scya21a
SWISS: P84444
GeneID: 18829
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CCchemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signalpeptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms whileCCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 andCXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro forthymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 showspreferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes tosecondary lymphoid organs.
Source: Pichia
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only